PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Manes.11G137700.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Manihoteae; Manihot
Family WOX
Protein Properties Length: 105aa    MW: 12399.3 Da    PI: 10.7428
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Manes.11G137700.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox65.57.1e-21766357
                         --SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
             Homeobox  3 kRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57
                         +R+++t+eql +Leel+++  r+p+a+++++++++l    +++ ++V++WFqN++a++++
  Manes.11G137700.1.p  7 SRWCPTPEQLMILEELYRSgIRTPNASQIQRITSHLslygKIEGKNVFYWFQNHKARDRQ 66
                         7*****************99*************************************996 PP

2Wus_type_Homeobox1231.1e-39567264
    Wus_type_Homeobox  2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqk 64
                         a++RW+PtpeQ++iLeely+sG+rtPn+++iqrit++L+ yGkie+kNVfyWFQN+kaR+rqk
  Manes.11G137700.1.p  5 ASSRWCPTPEQLMILEELYRSGIRTPNASQIQRITSHLSLYGKIEGKNVFYWFQNHKARDRQK 67
                         689***********************************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007110.139267IPR001356Homeobox domain
SMARTSM003891.5E-5471IPR001356Homeobox domain
PfamPF000461.2E-18766IPR001356Homeobox domain
SuperFamilySSF466897.27E-12767IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.1E-8766IPR009057Homeodomain-like
CDDcd000864.34E-4867No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008283Biological Processcell proliferation
GO:0009908Biological Processflower development
GO:0009943Biological Processadaxial/abaxial axis specification
GO:0009947Biological Processcentrolateral axis specification
GO:0010865Biological Processstipule development
GO:0048513Biological Processanimal organ development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 105 aa     Download sequence    Send to blast
MSPAASSRWC PTPEQLMILE ELYRSGIRTP NASQIQRITS HLSLYGKIEG KNVFYWFQNH  60
KARDRQKLRR KLLKQLQHNQ IYLQNQSPPF HPLPYHHSPA LLPQV
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015583111.16e-50PREDICTED: WUSCHEL-related homeobox 3
SwissprotQ9SIB48e-44WOX3_ARATH; WUSCHEL-related homeobox 3
TrEMBLB9T3K12e-50B9T3K1_RICCO; Putative uncharacterized protein
STRINGVIT_06s0004g03780.t012e-44(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF106322940
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G28610.15e-39WOX family protein